multi-av / NTFS4DOS / boot floppy...

  • Thread starter Thread starter RJK
  • Start date Start date
....a little progress :-)

Well, I've just had another "go." I overwrote my old sophos.kix with the
one you kindly attached, and after rebooting | booted from W98se / ntfs4dos
floppy and got the same result "...dos4gw.exe not found. So started Windows
| ran startmenu.bat | 1 | Ctrl+C'd it, then took a peek in
c:\av-cls\sophos and saw that dos4gw.exe was in there,
....so booted from floppy | ran ntfs4dos (which seems to be working properly
at last i.e. it identifies all my drives), made the current directory
c:\av-cls and ran sofclean.bat and I get:-

Warning: Temp environment variable not set
Virus Data File c:\av-cls\sophos\ is corrupted - ignored
Version 4.07, July 2006
includes detection for 123892 Viri , Trojans, and Worms (just kidding - it
said "Viruses")
....time ....date etc
Full Sweep

....have to abandon it now - bed time :-( ...have to be up early in morning.
Next time I get some time on my PC I'll reinstall multi-av, and have a dig
around and try to find out what needs a Temp directory.

regards, Richard
 
From: "RJK" <[email protected]>

| ...a little progress :-)
|
| Well, I've just had another "go." I overwrote my old sophos.kix with the
| one you kindly attached, and after rebooting | booted from W98se / ntfs4dos
| floppy and got the same result "...dos4gw.exe not found. So started Windows
|> ran startmenu.bat | 1 | Ctrl+C'd it, then took a peek in
| c:\av-cls\sophos and saw that dos4gw.exe was in there,
| ...so booted from floppy | ran ntfs4dos (which seems to be working properly
| at last i.e. it identifies all my drives), made the current directory
| c:\av-cls and ran sofclean.bat and I get:-
|
| Warning: Temp environment variable not set
| Virus Data File c:\av-cls\sophos\ is corrupted - ignored
| Version 4.07, July 2006
| includes detection for 123892 Viri , Trojans, and Worms (just kidding - it
| said "Viruses")
| ...time ....date etc
| Full Sweep
|
| ...have to abandon it now - bed time :-( ...have to be up early in morning.
| Next time I get some time on my PC I'll reinstall multi-av, and have a dig
| around and try to find out what needs a Temp directory.
|
| regards, Richard
|

I'm sorry I wasn't clearer in my instructions.

After you dropped the NEW version of Sophos.kic in the C:\AV-CLS folder, you need to be in
windows and run the menu and choose Sophos from the menu. Then it will extract the
dos4gw.exe file and then you can boot from the DOS Boot Disk.

My apologoes Richard for not fully expressing the above.
 
| - the RAM disk driver (can't recall the name)

Quote my Startup Diskette readme...

Ramdrive.sys Creates a Ramdrive during startup
Setramd.bat Searches for first available drive to be a Ramdrive


Welcome baaaaack, cquirke! Recuperating from XP burns?


--
Thanks or Good Luck,
There may be humor in this post, and,
Naturally, you will not sue,
should things get worse after this,
PCR
(e-mail address removed)
| On Mon, 3 Jul 2006 12:48:56 +0100, "RJK" <[email protected]>
|
| >Just before rechecking this thread, I made an MSDOS boot floppy using XP
| >Home ed, and put ntf4dos.exe on it. i.e.
| >dir a:\ > a:\list.txt
|
| > Directory of A:\
|
| FWIW, here's the file set I would retain...
|
| >08/06/2000 17:00 93,040 COMMAND.COM
| >03/07/2006 00:18 0 AUTOEXEC.BAT
| >03/07/2006 00:18 0 CONFIG.SYS
| >21/02/2006 17:38 118,667 ntfs4dos.exe
|
| ...to which I'd add...
| - HiMem.sys
| - OakCDROM.sys (I prefer AOATAPI.sys)
| - MSCDEx.exe
| - SmartDrv.exe
| - DOSKey.*
| ...and to taste...
| - Edit.com
| - Sys.com
| - Attrib.exe
| - Emm386.exe
| - the RAM disk driver (can't recall the name)
| - Scandisk.exe
| - FC.exe
| ...and 3rd-party tools to taste...
| - PKUnZip.exe
| - Extract.exe
| - LL3.exe
| - DiskEdit.exe
| - UnErase.exe
| - Mouse.com
| - LFN TSR and/or Odi's LCopy.exe
| - ReadNTFS and/or NTFS driver TSR
| ...as space permits.
|
| >...and XP mindlessly placed an empty config.sys and autoexec.bat on it!
|
| Well, these *are* custom-editable files, after all. I can't imagine
| ever using "stock" ones without some tinkering :-)
|
| >I booted up using it, ran ntf4dos and said "Yes" to the copyright threat
|
| >...changed to drive c:\ and mde the current directory c:\av-cls
| >...ran the batch file SOFclean.bat
| >...and got "...Sophos commmand line scanner is unable to find DOS4GW.exe"
| >(or message to that effect)
| >..so off I go in to the past again ! :-)
|
| Sounds like a Path issue. I'd add C:\AV-CLS to the Path that is in
| A:\Config.sys (use Set Path= syntax) or A:\AutoExec.bat
|
| >I'm going to now tweak an old W98se boot up floppy, and configure config.sys
| >and autoexec.bat myself !
|
| Sure... I usually create a [Menu] in Config.sys offering...
| - HiMem, Emm386, CD, RAMdrive, SmartDrv
| - HiMem, Emm386, CD, RAMdrive
| - HiMem, Emm386, CD
| - HiMem, Emm386
| - HiMem
| - Clean
| ...and add DOSKey /Insert to all options where it can be loaded high
| (i.e. all but the last two). Most DOS NTFS drivers take huge amount
| of memory, so I don't use those much (I'd use Bart CDR in that context
| instead). Also, remember the limitations of NTFS DOS drivers...
| - huge memory use, as noted
| - often fails to fully traverse the file system
| - may not do (or do safely) writes to NTFS
| - may depend on NTFS.SYS and thus crash if that crashes
| - no built-in LFN support (load LFN TSR driver first)
|
| The two NTFS drivers I'm familiar with are...
| - SystemInternals freeware (read-only, no LFNs, NTFS.sys-free)
| - SystemInternals feeware (read/write, no LFNs, uses NTFS.sys?)
| ...and I've only used the first. I generally prefer non-TSR ReadNTFS
| and Odi's LFN Tools, even though they mean no NTFS and LFNs at the
| same time. Note that one of the two free DOS LFN driver TSR is
| seriously buggy for LFN writes (the "n" in *~n.* does not incriment!)
|
|
| >-- Risk Management is the clue that asks:
| "Why do I keep open buckets of petrol next to all the
| ashtrays in the lounge, when I don't even have a car?"
| >----------------------- ------ ---- --- -- - - - -
 
Nah - more likely mass-attack by sheep!
:)

--
Noel Paton (MS-MVP 2002-2006, Windows)

Nil Carborundum Illegitemi
http://www.crashfixpc.com


<snip>
Welcome baaaaack, cquirke! Recuperating from XP burns?


--
Thanks or Good Luck,
There may be humor in this post, and,
Naturally, you will not sue,
should things get worse after this,
PCR
 
I didn't SEE any sheep at that site you posted, though! And how dare you invite our cquirke to your side of Scotland, w/o warning him about killer sheep first...?...


--
Thanks or Good Luck,
There may be humor in this post, and,
Naturally, you will not sue,
should things get worse after this,
PCR
(e-mail address removed)
| Nah - more likely mass-attack by sheep!
| :)
|
| --
| Noel Paton (MS-MVP 2002-2006, Windows)
|
| Nil Carborundum Illegitemi
| http://www.crashfixpc.com
|
|
| | <snip>
| Welcome baaaaack, cquirke! Recuperating from XP burns?
|
|
| --
| Thanks or Good Luck,
| There may be humor in this post, and,
| Naturally, you will not sue,
| should things get worse after this,
| PCR
|
 
I'm in Wales, dear boy - not Scotland! you knowledge of the British Isles is
execrable, and sorely in need of some remedial treatment!

--
Noel Paton (MS-MVP 2002-2006, Windows)

Nil Carborundum Illegitemi
http://www.crashfixpc.com

http://tinyurl.com/6oztj

Please read on how to post messages to NG's
I didn't SEE any sheep at that site you posted, though! And how dare you
invite our cquirke to your side of Scotland, w/o warning him about killer
sheep first...?...


--
Thanks or Good Luck,
There may be humor in this post, and,
Naturally, you will not sue,
should things get worse after this,
PCR
(e-mail address removed)
| Nah - more likely mass-attack by sheep!
| :)
|
| --
| Noel Paton (MS-MVP 2002-2006, Windows)
|
| Nil Carborundum Illegitemi
| http://www.crashfixpc.com
|
|
| | <snip>
| Welcome baaaaack, cquirke! Recuperating from XP burns?
|
|
| --
| Thanks or Good Luck,
| There may be humor in this post, and,
| Naturally, you will not sue,
| should things get worse after this,
| PCR
|
 
You were swallowed by a Wale?! That's even worse!


--
Thanks or Good Luck,
There may be humor in this post, and,
Naturally, you will not sue,
should things get worse after this,
PCR
(e-mail address removed)
| I'm in Wales, dear boy - not Scotland! you knowledge of the British Isles is
| execrable, and sorely in need of some remedial treatment!
|
| --
| Noel Paton (MS-MVP 2002-2006, Windows)
|
| Nil Carborundum Illegitemi
| http://www.crashfixpc.com
|
| http://tinyurl.com/6oztj
|
| Please read on how to post messages to NG's
| | I didn't SEE any sheep at that site you posted, though! And how dare you
| invite our cquirke to your side of Scotland, w/o warning him about killer
| sheep first...?...
| |
|
| --
| Thanks or Good Luck,
| There may be humor in this post, and,
| Naturally, you will not sue,
| should things get worse after this,
| PCR
| (e-mail address removed)
| | | Nah - more likely mass-attack by sheep!
| | :)
| |
| | --
| | Noel Paton (MS-MVP 2002-2006, Windows)
| |
| | Nil Carborundum Illegitemi
| | http://www.crashfixpc.com
| |
| |
| | | | <snip>
| | Welcome baaaaack, cquirke! Recuperating from XP burns?
| |
| |
| | --
| | Thanks or Good Luck,
| | There may be humor in this post, and,
| | Naturally, you will not sue,
| | should things get worse after this,
| | PCR
| |
|
 
Thanks for your response :-) You indeed were originally clear i.e.
....me as usual not being clear as to what I really did :-)

After replacing Sophos.kix , I fired-up Sophos in Windows normal mode |
prodded 1 for the Sophos scan | let it do it's file compare/retrieval thing-
waited for it to start scanning files | then Ctrl+c'd it and took a peek
in the c:\av-cls directory and saw that dos4gw.exe was in there :-

Then I booted from my "fiddled with" W98se boot floppy | ran ntfs4dos.exe
which gave me access to my ntfs drives, (dos4gw.exe present in the
c:\av-cls directory), and then made the current drive:\directory c:\av-cls
and ran sofclean.bat which coughed up... :-

Warning: Temp environment variable not set
Virus Data File c:\av-cls\sophos\ is corrupted - ignored
Version 4.07, July 2006
includes detection for 123892 Viruses, Trojans, and Worms
....time ....date etc
Full Sweep

....at the dos prompt. So it looks like something is looking for the Temp
environment variable and not finding one hasn't got enough room to work,
probably sweep.exe ? , ...or even dos4gw.exe ...anyway I'll just tweak my
floppy to set a Temp directory somewhere - I could even get carried aways
and ambitious and make use of ramdrive.sys that I left on floppy !
.......Why did I throw out those books in which I was always looking up dos
external commands syntax !?

....I'll also take a peek at the FreeDos boot up floppy and see what that is
doing during boot up; ...rather I think that the datapol floppy creation
proc. that created a FreeDos boot up floppy and placed ntfs4dos.exe on it,
was setting a ramdisk but, that floppy didn't work well for me and my first
message after POST using that FreeDos/ntfs4dos.exe boot floppy was "NO UMBS
available"

....I do ramble on - ...I didn't have time to turn on the PC yesterday, and
I'm going to have another "go" at all this a little later on tonight.

regards, Richard
 
uuummm! ...I've given up !

I think I'll just remain grateful to David H. Lipman for his multi-av tool
as it is,
and as and when I've got the time, I'll fiddle with those command line
scanners myself i.e. I need to find out a lot more about them.
I thought it would have been reasonably easy to have configured a boot-up
floppy, run ntfs4dos.exe, and then use them but, it's definately not that
simple. Even the datapol tool to create a FreeDos boot-floppy that
automatically runs ntfs4dos.exe would not work properly on my PC. When I
have the time I'll closely examine that disk and try to track down the
problems. I tried the datapol tool several times with several different
floppy disks.

Configuring an old W98se floppy, and slapping ntfs4dos.exe on it seemed to
work well inasmuch as it booted up okay and ntfs4dos.exe ran okay, ...but,
I get a continuous sneaky feeling that there's some sort of incompatibility
going on in there somewhere, and the Sophos command line scanner sweep.exe
is not really happy running under W98se/MilleniumDOS and/or having
ntfs4dos.exe in between there somewhere doing things !

regards, Richard
 
....thanks young man :-)

I may give it another go but, It's taking me so long to make progress, I may
die of old age !
David H Lipman threw in some help by tweaking his Sophos.kix file so that
dos4gw.exe is placed into the c:\av-cls\sophos directory but, my attempts to
boot from a dos floppy | run ntfs4dos.exe and then run cls's from hd still
keep failing ! I'm sure there's some software incompatibility in there
somewhere !

regards, Richard


cquirke (MVP Windows shell/user) said:
Just before rechecking this thread, I made an MSDOS boot floppy using XP
Home ed, and put ntf4dos.exe on it. i.e.
dir a:\ > a:\list.txt
Directory of A:\

FWIW, here's the file set I would retain...
08/06/2000 17:00 93,040 COMMAND.COM
03/07/2006 00:18 0 AUTOEXEC.BAT
03/07/2006 00:18 0 CONFIG.SYS
21/02/2006 17:38 118,667 ntfs4dos.exe

...to which I'd add...
- HiMem.sys
- OakCDROM.sys (I prefer AOATAPI.sys)
- MSCDEx.exe
- SmartDrv.exe
- DOSKey.*
...and to taste...
- Edit.com
- Sys.com
- Attrib.exe
- Emm386.exe
- the RAM disk driver (can't recall the name)
- Scandisk.exe
- FC.exe
...and 3rd-party tools to taste...
- PKUnZip.exe
- Extract.exe
- LL3.exe
- DiskEdit.exe
- UnErase.exe
- Mouse.com
- LFN TSR and/or Odi's LCopy.exe
- ReadNTFS and/or NTFS driver TSR
...as space permits.
...and XP mindlessly placed an empty config.sys and autoexec.bat on it!

Well, these *are* custom-editable files, after all. I can't imagine
ever using "stock" ones without some tinkering :-)
I booted up using it, ran ntf4dos and said "Yes" to the copyright
threat
...changed to drive c:\ and mde the current directory c:\av-cls
...ran the batch file SOFclean.bat
...and got "...Sophos commmand line scanner is unable to find
DOS4GW.exe"
(or message to that effect)
..so off I go in to the past again ! :-)

Sounds like a Path issue. I'd add C:\AV-CLS to the Path that is in
A:\Config.sys (use Set Path= syntax) or A:\AutoExec.bat
I'm going to now tweak an old W98se boot up floppy, and configure
config.sys
and autoexec.bat myself !

Sure... I usually create a [Menu] in Config.sys offering...
- HiMem, Emm386, CD, RAMdrive, SmartDrv
- HiMem, Emm386, CD, RAMdrive
- HiMem, Emm386, CD
- HiMem, Emm386
- HiMem
- Clean
...and add DOSKey /Insert to all options where it can be loaded high
(i.e. all but the last two). Most DOS NTFS drivers take huge amount
of memory, so I don't use those much (I'd use Bart CDR in that context
instead). Also, remember the limitations of NTFS DOS drivers...
- huge memory use, as noted
- often fails to fully traverse the file system
- may not do (or do safely) writes to NTFS
- may depend on NTFS.SYS and thus crash if that crashes
- no built-in LFN support (load LFN TSR driver first)

The two NTFS drivers I'm familiar with are...
- SystemInternals freeware (read-only, no LFNs, NTFS.sys-free)
- SystemInternals feeware (read/write, no LFNs, uses NTFS.sys?)
...and I've only used the first. I generally prefer non-TSR ReadNTFS
and Odi's LFN Tools, even though they mean no NTFS and LFNs at the
same time. Note that one of the two free DOS LFN driver TSR is
seriously buggy for LFN writes (the "n" in *~n.* does not incriment!)

-- Risk Management is the clue that asks:
"Why do I keep open buckets of petrol next to all the
ashtrays in the lounge, when I don't even have a car?"
----------------------- ------ ---- --- -- - - - -
 
I'm in Wales, dear boy - not Scotland! you knowledge of the British Isles is
execrable, and sorely in need of some remedial treatment!

heh heh,,,,, write down the name of 'THAT' train station in Wales,
lets see if pcr can pronounce it.
Gekko
 
Gekko said:
Isles

heh heh,,,,, write down the name of 'THAT' train station in Wales,


Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

aka

Llanfair PG

[It is actually quite easy to say, once you know how]

It means

St. Mary's Church in the hollow of white hazel near a rapid whirlpool
and the Church of St. Tysilio near the red cave."

It isn't the longest. either.

Krungthepmahanakornamornratanakosinmahintarayutthayamaha
dilokphopnopparatrajathaniburiromudomrajaniwesmahasatharna
mornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand has that distinction.
 
|
| > I'm in Wales, dear boy - not Scotland! you knowledge of the British Isles
| is
| > execrable, and sorely in need of some remedial treatment!
| >
| > --
| > Noel Paton (MS-MVP 2002-2006, Windows)
|
| heh heh,,,,, write down the name of 'THAT' train station in Wales,
| lets see if pcr can pronounce it.
| Gekko

If you make him say it backwards, he goes back to his own dimension!
 
ROFLMAO

|
| > I'm in Wales, dear boy - not Scotland! you knowledge of the British
Isles
| is
| > execrable, and sorely in need of some remedial treatment!
| >
| > --
| > Noel Paton (MS-MVP 2002-2006, Windows)
|
| heh heh,,,,, write down the name of 'THAT' train station in Wales,
| lets see if pcr can pronounce it.
| Gekko

If you make him say it backwards, he goes back to his own dimension!
 
Hugh Candlin said:
Gekko said:
Isles

heh heh,,,,, write down the name of 'THAT' train station in Wales,


Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

aka

Llanfair PG

[It is actually quite easy to say, once you know how]

It means

St. Mary's Church in the hollow of white hazel near a rapid whirlpool
and the Church of St. Tysilio near the red cave."

It isn't the longest. either.

Krungthepmahanakornamornratanakosinmahintarayutthayamaha
dilokphopnopparatrajathaniburiromudomrajaniwesmahasatharna
mornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand has that distinction.

Ah - but that doesn't have a web domain! :)
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/
http://llanfairpwllgwyngyllgogerych...llgogerychwyrndrobwllllantysiliogogogoch.html


--
Noel Paton (MS-MVP 2002-2006, Windows)

Nil Carborundum Illegitemi
http://www.crashfixpc.com

http://tinyurl.com/6oztj

Please read on how to post messages to NG's
 
LMAO! You've gotta be kidding!!

--
\m/ O_O \m/
Laura..... :)
Liverpool, England

Hugh Candlin said:
Gekko said:
Isles

heh heh,,,,, write down the name of 'THAT' train station in Wales,


Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

aka

Llanfair PG

[It is actually quite easy to say, once you know how]

It means

St. Mary's Church in the hollow of white hazel near a rapid whirlpool
and the Church of St. Tysilio near the red cave."

It isn't the longest. either.

Krungthepmahanakornamornratanakosinmahintarayutthayamaha
dilokphopnopparatrajathaniburiromudomrajaniwesmahasatharna
mornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand has that distinction.
 
Ah, ha, ha. But I'm only joking!

MEB: Make up with them!


--
Thanks or Good Luck,
There may be humor in this post, and,
Naturally, you will not sue,
should things get worse after this,
PCR
(e-mail address removed)
|
| If you make him say it backwards, he goes back to his own dimension!
|
| LOL...
|
|
 
LMAO! You've gotta be kidding!!

I swear on my stack of Ivor Emmanuel 78's,
every word is the truth.

There is such a place. The name even means something.

Quite a few things really.

Well, it has to - it didn't leave much out, did it?
 
Back
Top